← Main Index Directory
Tirzepatide Profile
metabolicCompound Summary
A synthetic linear peptide configured to target both GIP and GLP-1 receptors simultaneously. By utilizing dual-incretin action, it achieves significantly higher insulinotropic signaling efficiency than single GLP-1 analogues.
Verified Structural Chain Mapping
YXEGTFTSDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNIT
Clinical Mechanism Insight
Q: How does Tirzepatide function in metabolic research models?
A: Tirzepatide uses structural lipid conjugation to mimic native GIP and GLP-1 hormones, optimizing pancreatic beta-cell insulin transcription.