← Main Index Directory
Retatrutide Profile
metabolicCompound Summary
An experimental 39-amino acid peptide targeting three distinct metabolic pathways: GIP, GLP-1, and glucagon receptors. It dramatically shifts fat-burning kinetics by combining incretin hormone action with direct glucagon-mediated energy expenditure acceleration.
Verified Structural Chain Mapping
YSQGTFTSDYSKYLDSKKAKEFVEWLLAEGQGGPSSGAPPPS
Clinical Mechanism Insight
Q: What is Retatrutide used for in laboratory research?
A: Retatrutide maps multi-receptor metabolic adaptation by concurrently stimulating insulin secretion via GIP/GLP-1 while activating glucagon receptors to upregulate lipolysis and mitochondrial thermogenesis.